AS3MT antibody (70R-4474)

Rabbit polyclonal AS3MT antibody

Synonyms Polyclonal AS3MT antibody, Anti-AS3MT antibody, CYT19 antibody, ASMT 3 antibody, Arsenic antibody, ASMT-3, AS3MT, ASMT-3 antibody, ASMT 3
Cross Reactivity Human
Applications WB
Immunogen AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
Assay Information AS3MT Blocking Peptide, catalog no. 33R-3331, is also available for use as a blocking control in assays to test for specificity of this AS3MT antibody

Images

Western Blot analysis using AS3MT antibody (70R-4474)

AS3MT antibody (70R-4474) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AS3MT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AS3MT antibody (70R-4474) | AS3MT antibody (70R-4474) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors