ASAH1 antibody (70R-5484)

Rabbit polyclonal ASAH1 antibody

Synonyms Polyclonal ASAH1 antibody, Anti-ASAH1 antibody, AC antibody, PHP32 antibody, FLJ22079 antibody, PHP antibody, ASAH antibody, FLJ21558 antibody, Acid Ceramidase 1 antibody, N-Acylsphingosine Amidohydrolase antibody
Cross Reactivity Human
Applications WB
Immunogen ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP
Assay Information ASAH1 Blocking Peptide, catalog no. 33R-7724, is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody


Western Blot analysis using ASAH1 antibody (70R-5484)

ASAH1 antibody (70R-5484) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASAH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASAH1 antibody (70R-5484) | ASAH1 antibody (70R-5484) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors