ASB11 antibody (70R-3633)

Rabbit polyclonal ASB11 antibody raised against the C terminal of ASB11

Synonyms Polyclonal ASB11 antibody, Anti-ASB11 antibody, Ankyrin Repeat And Socs Box-Containing 11 antibody, MGC119168 antibody, MGC119169 antibody, DKFZp779E2460 antibody
Specificity ASB11 antibody was raised against the C terminal of ASB11
Cross Reactivity Human
Applications WB
Immunogen ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV
Assay Information ASB11 Blocking Peptide, catalog no. 33R-3519, is also available for use as a blocking control in assays to test for specificity of this ASB11 antibody

Images

Western Blot analysis using ASB11 antibody (70R-3633)

ASB11 antibody (70R-3633) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASB11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASB11 antibody (70R-3633) | ASB11 antibody (70R-3633) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors