ASF1B antibody (70R-2065)

Rabbit polyclonal ASF1B antibody

Synonyms Polyclonal ASF1B antibody, Anti-ASF1B antibody, CIA-II antibody, FLJ10604 antibody, Asf1 Anti Silencing Function 1 Homolog B antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ASF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH
Assay Information ASF1B Blocking Peptide, catalog no. 33R-10123, is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody


Western Blot analysis using ASF1B antibody (70R-2065)

ASF1B antibody (70R-2065) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASF1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASF1B antibody (70R-2065) | ASF1B antibody (70R-2065) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors