ASGR2 antibody (70R-1145)

Rabbit polyclonal ASGR2 antibody raised against the N terminal of ASGR2

Synonyms Polyclonal ASGR2 antibody, Anti-ASGR2 antibody, Asialoglycoprotein Receptor 2 antibody
Specificity ASGR2 antibody was raised against the N terminal of ASGR2
Cross Reactivity Human
Applications IHC, WB
Immunogen ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
Assay Information ASGR2 Blocking Peptide, catalog no. 33R-8876, is also available for use as a blocking control in assays to test for specificity of this ASGR2 antibody

Images

Western Blot analysis using ASGR2 antibody (70R-1145)

ASGR2 antibody (70R-1145) used at 4 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASGR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 4 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASGR2 antibody (70R-1145) | ASGR2 antibody (70R-1145) used at 4 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors