ASL antibody (70R-1176)

Rabbit polyclonal ASL antibody raised against the middle region of ASL

Synonyms Polyclonal ASL antibody, Anti-ASL antibody, ASAL antibody, Argininosuccinate Lyase antibody
Specificity ASL antibody was raised against the middle region of ASL
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Assay Information ASL Blocking Peptide, catalog no. 33R-5053, is also available for use as a blocking control in assays to test for specificity of this ASL antibody


Western Blot analysis using ASL antibody (70R-1176)

ASL antibody (70R-1176) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASL antibody (70R-1176) | ASL antibody (70R-1176) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors