ASPA antibody (70R-3492)

Rabbit polyclonal ASPA antibody

Synonyms Polyclonal ASPA antibody, Anti-ASPA antibody, Canavan Disease antibody, Aspartoacylase antibody, ACY2 antibody, ASP antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL
Assay Information ASPA Blocking Peptide, catalog no. 33R-4033, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody

Images

Western Blot analysis using ASPA antibody (70R-3492)

ASPA antibody (70R-3492) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASPA catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ASPA antibody (70R-3492) | ASPA antibody (70R-3492) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors