ASPHD2 antibody (70R-3531)

Rabbit polyclonal ASPHD2 antibody raised against the middle region of ASPHD2

Synonyms Polyclonal ASPHD2 antibody, Anti-ASPHD2 antibody, Aspartate Beta-Hydroxylase Domain Containing 2 antibody, FLJ39838 antibody
Specificity ASPHD2 antibody was raised against the middle region of ASPHD2
Cross Reactivity Human
Applications WB
Immunogen ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL
Assay Information ASPHD2 Blocking Peptide, catalog no. 33R-10060, is also available for use as a blocking control in assays to test for specificity of this ASPHD2 antibody


Western Blot analysis using ASPHD2 antibody (70R-3531)

ASPHD2 antibody (70R-3531) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASPHD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ASPH protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASPHD2 antibody (70R-3531) | ASPHD2 antibody (70R-3531) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors