Asporin antibody (70R-1594)

Rabbit polyclonal Asporin antibody raised against the middle region of ASPN

Synonyms Polyclonal Asporin antibody, Anti-Asporin antibody, PLAP1 antibody, FLJ20129 antibody, ASPN antibody, SLRR1C antibody
Specificity Asporin antibody was raised against the middle region of ASPN
Cross Reactivity Human,Rat
Applications IHC, WB
Immunogen Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Assay Information Asporin Blocking Peptide, catalog no. 33R-6743, is also available for use as a blocking control in assays to test for specificity of this Asporin antibody


Immunohistochemical staining using Asporin antibody (70R-1594)

Asporin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASPN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Asporin antibody (70R-1594) | Asporin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using Asporin antibody (70R-1594) | Asporin antibody (70R-1594) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors