ASS1 antibody (70R-1134)

Rabbit polyclonal ASS antibody raised against the C terminal Of Ass

Synonyms Polyclonal ASS1 antibody, Anti-ASS1 antibody, ASS 1 antibody, Argininosuccinate Synthase Type 1 antibody, DKFZp434P0216 antibody, CTLN1 antibody, ASS-1 antibody, ASS1, ASS-1 antibody, ASS 1, ASS-1
Specificity ASS1 antibody was raised against the C terminal Of Ass
Cross Reactivity Human
Applications IHC, WB
Immunogen ASS1 antibody was raised using the C terminal Of Ass corresponding to a region with amino acids SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
Assay Information ASS1 Blocking Peptide, catalog no. 33R-8918, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody


Immunohistochemical staining using ASS1 antibody (70R-1134)

ASS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASS catalyzes the penultimate step of the arginine biosynthetic pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ASS1 antibody (70R-1134) | ASS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ASS1 antibody (70R-1134) | ASS1 antibody (70R-1134) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors