ATG16L1 antibody (70R-2579)

Rabbit polyclonal ATG16L1 antibody

Synonyms Polyclonal ATG16L1 antibody, Anti-ATG16L1 antibody, FLJ22677 antibody, FLJ10828 antibody, ATG 16, ATG-16, WDR30 antibody, APG16L antibody, ATG-16 antibody, Atg16 Autophagy Related 16-Like 1 antibody, ATG16L antibody, ATG16, ATG 16 antibody, FLJ10035 antibody, IBD10 antibody, FLJ00045 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
Assay Information ATG16L1 Blocking Peptide, catalog no. 33R-7791, is also available for use as a blocking control in assays to test for specificity of this ATG16L1 antibody

Western blot analysis using ATG16L1 antibody (70R-2579)

Recommended ATG16L1 Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG16L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using ATG16L1 antibody (70R-2579) | Recommended ATG16L1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using ATG16L1 antibody (70R-2579) | Liver
  • Western blot analysis using ATG16L1 antibody (70R-2579) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors