ATP5B antibody (70R-1099)

Rabbit polyclonal ATP5B antibody raised against the N terminal of ATP5B

Synonyms Polyclonal ATP5B antibody, Anti-ATP5B antibody, MGC5231 antibody, ATPSB antibody, Atp Synthase H+ Transporting Mitochondrial F1 Complex Beta Polypeptide antibody, ATPMB antibody
Specificity ATP5B antibody was raised against the N terminal of ATP5B
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
Assay Information ATP5B Blocking Peptide, catalog no. 33R-7154, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody

Images

Western Blot analysis using ATP5B antibody (70R-1099)

ATP5B antibody (70R-1099) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATP5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP5B antibody (70R-1099) | ATP5B antibody (70R-1099) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using ATP5B antibody (70R-1099) | ATP5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors