ATP5F1 antibody (70R-2455)

Rabbit polyclonal ATP5F1 antibody raised against the middle region of ATP5F1

Synonyms Polyclonal ATP5F1 antibody, Anti-ATP5F1 antibody, PIG47 antibody, Atp Synthase H+ Transporting Mitochondrial F0 Complex Subunit B1 antibody, MGC24431 antibody
Specificity ATP5F1 antibody was raised against the middle region of ATP5F1
Cross Reactivity Human,Mouse
Applications WB
Immunogen ATP5F1 antibody was raised using the middle region of ATP5F1 corresponding to a region with amino acids VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
Assay Information ATP5F1 Blocking Peptide, catalog no. 33R-9863, is also available for use as a blocking control in assays to test for specificity of this ATP5F1 antibody


Western Blot analysis using ATP5F1 antibody (70R-2455)

ATP5F1 antibody (70R-2455) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP5F1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATP5F1 antibody (70R-2455) | ATP5F1 antibody (70R-2455) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors