ATP6V1B2 antibody (70R-2661)

Rabbit polyclonal ATP6V1B2 antibody raised against the middle region of ATP6V1B2

Synonyms Polyclonal ATP6V1B2 antibody, Anti-ATP6V1B2 antibody, Atpase H+ Transporting Lysosomal 56/58Kda V1 Subunit B2 antibody, VPP3 antibody, VATB antibody, HO57 antibody, Vma2 antibody, ATP6B2 antibody, ATP6B1B2 antibody
Specificity ATP6V1B2 antibody was raised against the middle region of ATP6V1B2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
Assay Information ATP6V1B2 Blocking Peptide, catalog no. 33R-6683, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Images

Western Blot analysis using ATP6V1B2 antibody (70R-2661)

ATP6V1B2 antibody (70R-2661) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V1B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6V1B2 antibody (70R-2661) | ATP6V1B2 antibody (70R-2661) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors