ATP8B2 antibody (70R-4519)

Rabbit polyclonal ATP8B2 antibody raised against the N terminal of ATP8B2

Synonyms Polyclonal ATP8B2 antibody, Anti-ATP8B2 antibody, DKFZp434M0219 antibody, ATPID antibody, KIAA1137 antibody, Atpase Class I Type 8B Member 2 antibody
Specificity ATP8B2 antibody was raised against the N terminal of ATP8B2
Cross Reactivity Human
Applications WB
Immunogen ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP
Assay Information ATP8B2 Blocking Peptide, catalog no. 33R-4690, is also available for use as a blocking control in assays to test for specificity of this ATP8B2 antibody

Images

Western Blot analysis using ATP8B2 antibody (70R-4519)

ATP8B2 antibody (70R-4519) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP8B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP8B2 antibody (70R-4519) | ATP8B2 antibody (70R-4519) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors