BCAS2 antibody (70R-5000)

Rabbit polyclonal BCAS2 antibody raised against the N terminal of BCAS2

Synonyms Polyclonal BCAS2 antibody, Anti-BCAS2 antibody, Breast Carcinoma Amplified Sequence 2 antibody, DAM1 antibody
Specificity BCAS2 antibody was raised against the N terminal of BCAS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL
Assay Information BCAS2 Blocking Peptide, catalog no. 33R-5671, is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody

Images

Western Blot analysis using BCAS2 antibody (70R-5000)

BCAS2 antibody (70R-5000) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BCAS2 antibody (70R-5000) | BCAS2 antibody (70R-5000) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors