BCHE antibody (70R-1889)

Rabbit polyclonal BCHE antibody raised against the N terminal of BCHE

Synonyms Polyclonal BCHE antibody, Anti-BCHE antibody, Butyrylcholinesterase antibody, E1 antibody, CHE1 antibody
Specificity BCHE antibody was raised against the N terminal of BCHE
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
Assay Information BCHE Blocking Peptide, catalog no. 33R-8821, is also available for use as a blocking control in assays to test for specificity of this BCHE antibody


Immunohistochemical staining using BCHE antibody (70R-1889)

BCHE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BCHE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using BCHE antibody (70R-1889) | BCHE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using BCHE antibody (70R-1889) | BCHE antibody (70R-1889) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £228.91
Size: 100 ug
View Our Distributors