BCKDK antibody (70R-3675)

Rabbit polyclonal BCKDK antibody raised against the N terminal of BCKDK

Synonyms Polyclonal BCKDK antibody, Anti-BCKDK antibody, Branched Chain Ketoacid Dehydrogenase Kinase antibody
Specificity BCKDK antibody was raised against the N terminal of BCKDK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD
Assay Information BCKDK Blocking Peptide, catalog no. 33R-1742, is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody


Western Blot analysis using BCKDK antibody (70R-3675)

BCKDK antibody (70R-3675) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCKDK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BCKDK antibody (70R-3675) | BCKDK antibody (70R-3675) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors