BCL7A antibody (70R-3771)

Rabbit polyclonal BCL7A antibody raised against the middle region of BCL7A

Synonyms Polyclonal BCL7A antibody, Anti-BCL7A antibody, BCL7 antibody, BCLA 7, BCL7A, BCLA-7, BCLA 7 antibody, BCLA-7 antibody, B-Cell Cll/Lymphoma 7A antibody
Specificity BCL7A antibody was raised against the middle region of BCL7A
Cross Reactivity Human
Applications WB
Immunogen BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
Assay Information BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody


Western Blot analysis using BCL7A antibody (70R-3771)

BCL7A antibody (70R-3771) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCL7A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BCL7A antibody (70R-3771) | BCL7A antibody (70R-3771) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors