BDH2 antibody (70R-4094)

Rabbit polyclonal BDH2 antibody raised against the middle region of BDH2

Synonyms Polyclonal BDH2 antibody, Anti-BDH2 antibody, DHRS6 antibody, FLJ13261 antibody, EFA6R antibody, 3-Hydroxybutyrate Dehydrogenase Type 2 antibody, UNQ6308 antibody, UCPA-OR antibody, PRO20933 antibody
Specificity BDH2 antibody was raised against the middle region of BDH2
Cross Reactivity Human
Applications WB
Immunogen BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR
Assay Information BDH2 Blocking Peptide, catalog no. 33R-6852, is also available for use as a blocking control in assays to test for specificity of this BDH2 antibody

Images

Western Blot analysis using BDH2 antibody (70R-4094)

BDH2 antibody (70R-4094) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BDH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BDH2 is a dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. It also acts as a 3-hydroxybutyrate dehydrogenase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BDH2 antibody (70R-4094) | BDH2 antibody (70R-4094) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors