beta Actin antibody (70R-2519)

Rabbit polyclonal beta Actin antibody raised against the middle region of ACTB

Synonyms Polyclonal beta Actin antibody, Anti-beta Actin antibody, b-actin antibody, PS1TP5BP1 antibody, ACTB antibody, beta Actin antibody, beta-actin antibody
Specificity Beta Actin antibody was raised against the middle region of ACTB
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,Drosophila
Applications WB
Immunogen beta Actin antibody was raised using the middle region of ACTB corresponding to a region with amino acids TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
Assay Information Beta Actin Blocking Peptide, catalog no. 33R-9203, is also available for use as a blocking control in assays to test for specificity of this Beta Actin antibody


Western blot analysis using beta Actin antibody (70R-2519)

Tissue analyzed: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using beta Actin antibody (70R-2519) | Tissue analyzed: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using beta Actin antibody (70R-2519) | Sample type: 1-8.N2 WT C elegans (60ug) with beta Actin antibody at 1:2000
  • Western blot analysis using beta Actin antibody (70R-2519) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using beta Actin antibody (70R-2519) | Samples 1 - 8: N2 wild type C. elegans.
  • Western blot analysis using beta Actin antibody (70R-2519) | Recommended ACTB Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors