Beta Lactamase antibody (70R-2527)

Rabbit polyclonal Beta Lactamase antibody raised against the middle region of LACTB

Synonyms Polyclonal Beta Lactamase antibody, Anti-Beta Lactamase antibody, MRPL56 antibody, G24 antibody, LACTB antibody, FLJ14902 antibody, Lactamase Beta antibody
Specificity Beta Lactamase antibody was raised against the middle region of LACTB
Cross Reactivity Human
Applications WB
Immunogen Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
Assay Information Beta Lactamase Blocking Peptide, catalog no. 33R-7526, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody


Western Blot analysis using Beta Lactamase antibody (70R-2527)

Beta Lactamase antibody (70R-2527) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LACTB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Beta Lactamase antibody (70R-2527) | Beta Lactamase antibody (70R-2527) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors