BIVM antibody (70R-4093)

Rabbit polyclonal BIVM antibody raised against the middle region of BIVM

Synonyms Polyclonal BIVM antibody, Anti-BIVM antibody, MGC133326 antibody, Basic Immunoglobulin-Like Variable Motif Containing antibody
Specificity BIVM antibody was raised against the middle region of BIVM
Cross Reactivity Human
Applications WB
Immunogen BIVM antibody was raised using the middle region of BIVM corresponding to a region with amino acids PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK
Assay Information BIVM Blocking Peptide, catalog no. 33R-7073, is also available for use as a blocking control in assays to test for specificity of this BIVM antibody


Western Blot analysis using BIVM antibody (70R-4093)

BIVM antibody (70R-4093) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BIVM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of BIVM protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BIVM antibody (70R-4093) | BIVM antibody (70R-4093) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors