BRWD1 antibody (70R-2548)

Rabbit polyclonal BRWD1 antibody raised against the N terminal of BRWD1

Synonyms Polyclonal BRWD1 antibody, Anti-BRWD1 antibody, C21orf107 antibody, FLJ43918 antibody, Bromodomain And Wd Repeat Domain Containing 1 antibody, WDR9 antibody, N143 antibody
Specificity BRWD1 antibody was raised against the N terminal of BRWD1
Cross Reactivity Human
Applications WB
Immunogen BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK
Assay Information BRWD1 Blocking Peptide, catalog no. 33R-5643, is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody

Images

Western Blot analysis using BRWD1 antibody (70R-2548)

BRWD1 antibody (70R-2548) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRWD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BRWD1 antibody (70R-2548) | BRWD1 antibody (70R-2548) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors