BTF3L3 antibody (70R-4384)

Rabbit polyclonal BTF3L3 antibody raised against the middle region of BTF3L3

Synonyms Polyclonal BTF3L3 antibody, Anti-BTF3L3 antibody, Basic Transcription Factor 3 Like 3 antibody
Specificity BTF3L3 antibody was raised against the middle region of BTF3L3
Cross Reactivity Human
Applications WB
Immunogen BTF3L3 antibody was raised using the middle region of BTF3L3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK
Assay Information BTF3L3 Blocking Peptide, catalog no. 33R-1800, is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody


Western Blot analysis using BTF3L3 antibody (70R-4384)

BTF3L3 antibody (70R-4384) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTF3L3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BTF3L3 antibody (70R-4384) | BTF3L3 antibody (70R-4384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors