C10ORF132 antibody (70R-4206)

Rabbit polyclonal C10ORF132 antibody raised against the N terminal Of C10Orf132

Synonyms Polyclonal C10ORF132 antibody, Anti-C10ORF132 antibody, bA459F3.4 antibody, MGC131701 antibody, C10orf133 antibody, Chromosome 10 ORF, bA451M19.3 antibody, Chromosome ORF-10, Chromosome ORF-10 antibody, Chromosome ORF 10, Chromosome ORF 10 antibody
Specificity C10ORF132 antibody was raised against the N terminal Of C10Orf132
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ
Assay Information C10ORF132 Blocking Peptide, catalog no. 33R-5771, is also available for use as a blocking control in assays to test for specificity of this C10ORF132 antibody

Images

Western Blot analysis using C10ORF132 antibody (70R-4206)

C10ORF132 antibody (70R-4206) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10ORF132 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C10orf132 may be involved in protein transport from Golgi to cell surface (By similarity).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C10ORF132 antibody (70R-4206) | C10ORF132 antibody (70R-4206) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors