C10orf30 antibody (70R-3870)

Rabbit polyclonal C10orf30 antibody raised against the N terminal of C10orf30

Synonyms Polyclonal C10orf30 antibody, Anti-C10orf30 antibody, Chromosome ORF 10, MGC35247 antibody, Chromosome ORF 10 antibody, Chromosome 10 ORF, Ben Domain Containing 7 antibody, FLJ40283 antibody, Chromosome ORF-10 antibody, Chromosome ORF-10
Specificity C10orf30 antibody was raised against the N terminal of C10orf30
Cross Reactivity Human
Applications WB
Immunogen C10orf30 antibody was raised using the N terminal of C10orf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR
Assay Information C10orf30 Blocking Peptide, catalog no. 33R-1224, is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Images

Western Blot analysis using C10orf30 antibody (70R-3870)

C10orf30 antibody (70R-3870) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10orf30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C10orf30 antibody (70R-3870) | C10orf30 antibody (70R-3870) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors