C11ORF57 antibody (70R-3416)

Rabbit polyclonal C11ORF57 antibody raised against the middle region of C11Orf57

Synonyms Polyclonal C11ORF57 antibody, Anti-C11ORF57 antibody, Chromosome ORF-11, FLJ10726 antibody, Chromosome ORF-11 antibody, Chromosome 11 ORF, Chromosome ORF 11 antibody, Chromosome ORF 11
Specificity C11ORF57 antibody was raised against the middle region of C11Orf57
Cross Reactivity Human
Applications WB
Immunogen C11ORF57 antibody was raised using the middle region of C11Orf57 corresponding to a region with amino acids RWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKK
Assay Information C11ORF57 Blocking Peptide, catalog no. 33R-8264, is also available for use as a blocking control in assays to test for specificity of this C11ORF57 antibody

Images

Western Blot analysis using C11ORF57 antibody (70R-3416)

C11ORF57 antibody (70R-3416) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C11ORF57 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C11ORF57 antibody (70R-3416) | C11ORF57 antibody (70R-3416) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors