C12ORF4 antibody (70R-3506)

Rabbit polyclonal C12ORF4 antibody raised against the N terminal Of C12Orf4

Synonyms Polyclonal C12ORF4 antibody, Anti-C12ORF4 antibody, Chromosome ORF 12, Chromosome ORF-12 antibody, Chromosome ORF-12, FLJ21158 antibody, Chromosome ORF 12 antibody, Chromosome 12 ORF, FLJ23899 antibody
Specificity C12ORF4 antibody was raised against the N terminal Of C12Orf4
Cross Reactivity Human
Applications WB
Immunogen C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS
Assay Information C12ORF4 Blocking Peptide, catalog no. 33R-2390, is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody


Western Blot analysis using C12ORF4 antibody (70R-3506)

C12ORF4 antibody (70R-3506) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C12ORF4 antibody (70R-3506) | C12ORF4 antibody (70R-3506) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors