C12ORF40 antibody (70R-4212)

Rabbit polyclonal C12ORF40 antibody raised against the N terminal Of C12Orf40

Synonyms Polyclonal C12ORF40 antibody, Anti-C12ORF40 antibody, Chromosome ORF 12, FLJ40126 antibody, Chromosome ORF-12 antibody, Chromosome ORF-12, Chromosome ORF 12 antibody, Chromosome 12 ORF
Specificity C12ORF40 antibody was raised against the N terminal Of C12Orf40
Cross Reactivity Human
Applications WB
Immunogen C12ORF40 antibody was raised using the N terminal Of C12Orf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN
Assay Information C12ORF40 Blocking Peptide, catalog no. 33R-2601, is also available for use as a blocking control in assays to test for specificity of this C12ORF40 antibody


Western Blot analysis using C12ORF40 antibody (70R-4212)

C12ORF40 antibody (70R-4212) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF40 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C12orf40 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C12ORF40 antibody (70R-4212) | C12ORF40 antibody (70R-4212) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors