C13ORF28 antibody (70R-3516)

Rabbit polyclonal C13ORF28 antibody raised against the middle region of C13Orf28

Synonyms Polyclonal C13ORF28 antibody, Anti-C13ORF28 antibody, Chromosome ORF-13 antibody, Chromosome ORF 13 antibody, Chromosome ORF-13, Chromosome ORF 13, Chromosome 13 ORF, FLJ27356 antibody
Specificity C13ORF28 antibody was raised against the middle region of C13Orf28
Cross Reactivity Human
Applications WB
Immunogen C13ORF28 antibody was raised using the middle region of C13Orf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ
Assay Information C13ORF28 Blocking Peptide, catalog no. 33R-7105, is also available for use as a blocking control in assays to test for specificity of this C13ORF28 antibody


Western Blot analysis using C13ORF28 antibody (70R-3516)

C13ORF28 antibody (70R-3516) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C13ORF28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C13ORF28 antibody (70R-3516) | C13ORF28 antibody (70R-3516) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors