C13ORF31 antibody (70R-4182)

Rabbit polyclonal C13ORF31 antibody raised against the middle region of C13Orf31

Synonyms Polyclonal C13ORF31 antibody, Anti-C13ORF31 antibody, FLJ38725 antibody, Chromosome ORF 13 antibody, Chromosome ORF-13 antibody, Chromosome ORF 13, DKFZp686D11119 antibody, Chromosome 13 ORF, Chromosome ORF-13
Specificity C13ORF31 antibody was raised against the middle region of C13Orf31
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C13ORF31 antibody was raised using the middle region of C13Orf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN
Assay Information C13ORF31 Blocking Peptide, catalog no. 33R-9117, is also available for use as a blocking control in assays to test for specificity of this C13ORF31 antibody

Images

Western Blot analysis using C13ORF31 antibody (70R-4182)

C13ORF31 antibody (70R-4182) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C13ORF31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C13orf31 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C13ORF31 antibody (70R-4182) | C13ORF31 antibody (70R-4182) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors