C14ORF130 antibody (70R-1165)

Rabbit polyclonal C14ORF130 antibody raised against the middle region of C14Orf130

Synonyms Polyclonal C14ORF130 antibody, Anti-C14ORF130 antibody, Chromosome ORF-14 antibody, MGC9518 antibody, Chromosome ORF 14 antibody, Chromosome ORF-14, Chromosome 14 ORF, FLJ10483 antibody, Chromosome ORF 14
Specificity C14ORF130 antibody was raised against the middle region of C14Orf130
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen C14ORF130 antibody was raised using the middle region of C14Orf130 corresponding to a region with amino acids MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV
Assay Information C14ORF130 Blocking Peptide, catalog no. 33R-6118, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody


Immunohistochemical staining using C14ORF130 antibody (70R-1165)

C14ORF130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C14ORF130 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using C14ORF130 antibody (70R-1165) | C14ORF130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using C14ORF130 antibody (70R-1165) | C14ORF130 antibody (70R-1165) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors