C14ORF21 antibody (70R-4983)

Rabbit polyclonal C14ORF21 antibody raised against the middle region of C14Orf21

Synonyms Polyclonal C14ORF21 antibody, Anti-C14ORF21 antibody, Chromosome ORF-14, Chromosome ORF 14, Chromosome ORF-14 antibody, KIAA2021 antibody, Chromosome ORF 14 antibody, Chromosome 14 ORF
Specificity C14ORF21 antibody was raised against the middle region of C14Orf21
Cross Reactivity Human
Applications WB
Immunogen C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
Assay Information C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody


Western Blot analysis using C14ORF21 antibody (70R-4983)

C14ORF21 antibody (70R-4983) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C14orf21 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C14ORF21 antibody (70R-4983) | C14ORF21 antibody (70R-4983) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors