C14ORF44 antibody (70R-4163)

Rabbit polyclonal C14ORF44 antibody raised against the middle region of C14Orf44

Synonyms Polyclonal C14ORF44 antibody, Anti-C14ORF44 antibody, Chromosome ORF 14, Chromosome ORF-14, Chromosome 14 ORF, Chromosome ORF 14 antibody, c14_5547 antibody, FLJ31697 antibody, Chromosome ORF-14 antibody
Specificity C14ORF44 antibody was raised against the middle region of C14Orf44
Cross Reactivity Human,Mouse
Applications WB
Immunogen C14ORF44 antibody was raised using the middle region of C14Orf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ
Assay Information C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody

Images

Western Blot analysis using C14ORF44 antibody (70R-4163)

C14ORF44 antibody (70R-4163) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF44 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF44 antibody (70R-4163) | C14ORF44 antibody (70R-4163) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors