C15ORF15 antibody (70R-3901)

Rabbit polyclonal C15ORF15 antibody raised against the middle region of C15Orf15

Synonyms Polyclonal C15ORF15 antibody, Anti-C15ORF15 antibody, Chromosome ORF 15, RPL24L antibody, HRP-L30-iso antibody, Chromosome 15 ORF, RPL24 antibody, L30 antibody, Chromosome ORF-15 antibody, Chromosome ORF 15 antibody, Chromosome ORF-15, RLP24 antibody
Specificity C15ORF15 antibody was raised against the middle region of C15Orf15
Cross Reactivity Human
Applications WB
Immunogen C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
Assay Information C15ORF15 Blocking Peptide, catalog no. 33R-2931, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody

Images

Western Blot analysis using C15ORF15 antibody (70R-3901)

C15ORF15 antibody (70R-3901) used at 0.0625 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C15ORF15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.0625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 15 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C15ORF15 antibody (70R-3901) | C15ORF15 antibody (70R-3901) used at 0.0625 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors