C17ORF48 antibody (70R-3640)

Rabbit polyclonal C17ORF48 antibody raised against the N terminal Of C17Orf48

Synonyms Polyclonal C17ORF48 antibody, Anti-C17ORF48 antibody, Chromosome ORF 17 antibody, NBLA03831 antibody, MDS006 antibody, Chromosome ORF-17 antibody, Chromosome 17 ORF, Chromosome ORF 17, Chromosome ORF-17
Specificity C17ORF48 antibody was raised against the N terminal Of C17Orf48
Cross Reactivity Human
Applications WB
Immunogen C17ORF48 antibody was raised using the N terminal Of C17Orf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL
Assay Information C17ORF48 Blocking Peptide, catalog no. 33R-5825, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody


Western Blot analysis using C17ORF48 antibody (70R-3640)

C17ORF48 antibody (70R-3640) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF48 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C17ORF48 hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C17ORF48 antibody (70R-3640) | C17ORF48 antibody (70R-3640) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors