C17ORF71 antibody (70R-4365)

Rabbit polyclonal C17ORF71 antibody raised against the middle region of C17Orf71

Synonyms Polyclonal C17ORF71 antibody, Anti-C17ORF71 antibody, Chromosome ORF-17, FLJ10587 antibody, Chromosome ORF-17 antibody, Chromosome ORF 17 antibody, Chromosome 17 ORF, Chromosome ORF 17
Specificity C17ORF71 antibody was raised against the middle region of C17Orf71
Cross Reactivity Human
Applications WB
Immunogen C17ORF71 antibody was raised using the middle region of C17Orf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
Assay Information C17ORF71 Blocking Peptide, catalog no. 33R-3702, is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody


Western Blot analysis using C17ORF71 antibody (70R-4365)

C17ORF71 antibody (70R-4365) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF71 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C17ORF71 antibody (70R-4365) | C17ORF71 antibody (70R-4365) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors