C17ORF81 antibody (70R-3959)

Rabbit polyclonal C17ORF81 antibody raised against the C terminal Of C17Orf81

Synonyms Polyclonal C17ORF81 antibody, Anti-C17ORF81 antibody, Chromosome ORF 17, DERP6 antibody, Chromosome ORF 17 antibody, Chromosome ORF-17 antibody, Chromosome 17 ORF, HSPC002 antibody, MST071 antibody, MSTP071 antibody, Chromosome ORF-17
Specificity C17ORF81 antibody was raised against the C terminal Of C17Orf81
Cross Reactivity Human
Applications WB
Immunogen C17ORF81 antibody was raised using the C terminal Of C17Orf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE
Assay Information C17ORF81 Blocking Peptide, catalog no. 33R-3064, is also available for use as a blocking control in assays to test for specificity of this C17ORF81 antibody


Western Blot analysis using C17ORF81 antibody (70R-3959)

C17ORF81 antibody (70R-3959) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF81 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C17ORF81 antibody (70R-3959) | C17ORF81 antibody (70R-3959) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors