C18orf25 antibody (70R-4005)

Rabbit polyclonal C18orf25 antibody raised against the N terminal of C18orf25

Synonyms Polyclonal C18orf25 antibody, Anti-C18orf25 antibody, Chromosome 18 Open Reading Frame 25 antibody, Chromosome 18 ORF, Chromosome ORF 18, Chromosome ORF 18 antibody, ARKL1 antibody, Chromosome ORF-18 antibody, MGC12909 antibody, Chromosome ORF-18, MGC87799 antibody
Specificity C18orf25 antibody was raised against the N terminal of C18orf25
Cross Reactivity Human
Applications WB
Immunogen C18orf25 antibody was raised using the N terminal of C18orf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST
Assay Information C18orf25 Blocking Peptide, catalog no. 33R-6153, is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody


Western Blot analysis using C18orf25 antibody (70R-4005)

C18orf25 antibody (70R-4005) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C18orf25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C18orf25 antibody (70R-4005) | C18orf25 antibody (70R-4005) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors