C18ORF32 antibody (70R-4308)

Rabbit polyclonal C18ORF32 antibody raised against the middle region of C18Orf32

Synonyms Polyclonal C18ORF32 antibody, Anti-C18ORF32 antibody, FLJ23458 antibody, Chromosome ORF-18 antibody, Chromosome ORF-18, Chromosome ORF 18, Chromosome 18 ORF, Chromosome ORF 18 antibody
Specificity C18ORF32 antibody was raised against the middle region of C18Orf32
Cross Reactivity Human
Applications WB
Immunogen C18ORF32 antibody was raised using the middle region of C18Orf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK
Assay Information C18ORF32 Blocking Peptide, catalog no. 33R-7213, is also available for use as a blocking control in assays to test for specificity of this C18ORF32 antibody


Western Blot analysis using C18ORF32 antibody (70R-4308)

C18ORF32 antibody (70R-4308) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C18ORF32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C18ORF32 protein may activate the NF-kappa-B signaling pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C18ORF32 antibody (70R-4308) | C18ORF32 antibody (70R-4308) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors