C19ORF21 antibody (70R-4193)

Rabbit polyclonal C19ORF21 antibody raised against the C terminal Of C19Orf21

Synonyms Polyclonal C19ORF21 antibody, Anti-C19ORF21 antibody, Chromosome 19 ORF, Chromosome ORF 19 antibody, Chromosome ORF-19 antibody, DKFZp686H18209 antibody, Chromosome ORF 19, Chromosome ORF-19
Specificity C19ORF21 antibody was raised against the C terminal Of C19Orf21
Cross Reactivity Human
Applications WB
Immunogen C19ORF21 antibody was raised using the C terminal Of C19Orf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS
Assay Information C19ORF21 Blocking Peptide, catalog no. 33R-8150, is also available for use as a blocking control in assays to test for specificity of this C19ORF21 antibody


Western Blot analysis using C19ORF21 antibody (70R-4193)

C19ORF21 antibody (70R-4193) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C19orf21 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C19ORF21 antibody (70R-4193) | C19ORF21 antibody (70R-4193) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors