C19ORF47 antibody (70R-3346)

Rabbit polyclonal C19ORF47 antibody raised against the middle region of C19Orf47

Synonyms Polyclonal C19ORF47 antibody, Anti-C19ORF47 antibody, FLJ36888 antibody, Chromosome 19 ORF, DKFZp686P05129 antibody, Chromosome ORF-19 antibody, Chromosome ORF 19, Chromosome ORF 19 antibody, Chromosome ORF-19
Specificity C19ORF47 antibody was raised against the middle region of C19Orf47
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C19ORF47 antibody was raised using the middle region of C19Orf47 corresponding to a region with amino acids YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT
Assay Information C19ORF47 Blocking Peptide, catalog no. 33R-10277, is also available for use as a blocking control in assays to test for specificity of this C19ORF47 antibody

Images

Western Blot analysis using C19ORF47 antibody (70R-3346)

C19ORF47 antibody (70R-3346) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C19orf47 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF47 antibody (70R-3346) | C19ORF47 antibody (70R-3346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors