C1ORF110 antibody (70R-3688)

Rabbit polyclonal C1ORF110 antibody raised against the N terminal Of C1Orf110

Synonyms Polyclonal C1ORF110 antibody, Anti-C1ORF110 antibody, Chromosome ORF-1, Chromosome ORF 1 antibody, Chromosome 1 ORF, FLJ41579 antibody, Chromosome ORF-1 antibody, Chromosome ORF 1, MGC48998 antibody
Specificity C1ORF110 antibody was raised against the N terminal Of C1Orf110
Cross Reactivity Human,Mouse
Applications WB
Immunogen C1ORF110 antibody was raised using the N terminal Of C1Orf110 corresponding to a region with amino acids LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED
Assay Information C1ORF110 Blocking Peptide, catalog no. 33R-5112, is also available for use as a blocking control in assays to test for specificity of this C1ORF110 antibody

Images

Western Blot analysis using C1ORF110 antibody (70R-3688)

C1ORF110 antibody (70R-3688) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF110 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C1orf110 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1ORF110 antibody (70R-3688) | C1ORF110 antibody (70R-3688) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors