C1ORF92 antibody (70R-3711)

Rabbit polyclonal C1ORF92 antibody raised against the middle region of C1Orf92

Synonyms Polyclonal C1ORF92 antibody, Anti-C1ORF92 antibody, MGC45468 antibody, Chromosome ORF 1 antibody, Chromosome ORF-1, Chromosome ORF-1 antibody, Chromosome ORF 1, Chromosome 1 ORF, FLJ32884 antibody, RP11-356J7.1 antibody
Specificity C1ORF92 antibody was raised against the middle region of C1Orf92
Cross Reactivity Human
Applications WB
Immunogen C1ORF92 antibody was raised using the middle region of C1Orf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT
Assay Information C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody


Western Blot analysis using C1ORF92 antibody (70R-3711)

C1ORF92 antibody (70R-3711) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF92 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF92 antibody (70R-3711) | C1ORF92 antibody (70R-3711) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors