C1QTNF7 antibody (70R-5472)

Rabbit polyclonal C1QTNF7 antibody raised against the middle region of C1QTNF7

Synonyms Polyclonal C1QTNF7 antibody, Anti-C1QTNF7 antibody, C1Q And Tumor Necrosis Factor Related Protein 7 antibody, CQTNF-1 antibody, CQTNF 1, CQTNF-1, CQTNF 1 antibody, C1QTNF, CTRP7 antibody, ZACRP7 antibody
Specificity C1QTNF7 antibody was raised against the middle region of C1QTNF7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI
Assay Information C1QTNF7 Blocking Peptide, catalog no. 33R-8542, is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody


Western Blot analysis using C1QTNF7 antibody (70R-5472)

C1QTNF7 antibody (70R-5472) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QTNF7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C1QTNF7 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1QTNF7 antibody (70R-5472) | C1QTNF7 antibody (70R-5472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors