C20ORF141 antibody (70R-3827)

Rabbit polyclonal C20ORF141 antibody raised against the middle region of C20Orf141

Synonyms Polyclonal C20ORF141 antibody, Anti-C20ORF141 antibody, Chromosome 20 ORF, Chromosome ORF 20 antibody, Chromosome ORF-20, dJ860F19.4 antibody, Chromosome ORF 20, Chromosome ORF-20 antibody, MGC26144 antibody
Specificity C20ORF141 antibody was raised against the middle region of C20Orf141
Cross Reactivity Human
Applications WB
Immunogen C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL
Assay Information C20ORF141 Blocking Peptide, catalog no. 33R-8002, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody


Western Blot analysis using C20ORF141 antibody (70R-3827)

C20ORF141 antibody (70R-3827) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF141 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C20ORF141 antibody (70R-3827) | C20ORF141 antibody (70R-3827) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors