C20ORF141 antibody (70R-4134)

Rabbit polyclonal C20ORF141 antibody raised against the middle region of C20Orf141

Synonyms Polyclonal C20ORF141 antibody, Anti-C20ORF141 antibody, Chromosome ORF 20 antibody, Chromosome ORF 20, Chromosome ORF-20 antibody, MGC26144 antibody, dJ860F19.4 antibody, Chromosome 20 ORF, Chromosome ORF-20
Specificity C20ORF141 antibody was raised against the middle region of C20Orf141
Cross Reactivity Human,Mouse
Applications WB
Immunogen C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG
Assay Information C20ORF141 Blocking Peptide, catalog no. 33R-3864, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Images

Western Blot analysis using C20ORF141 antibody (70R-4134)

C20ORF141 antibody (70R-4134) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF141 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF141 antibody (70R-4134) | C20ORF141 antibody (70R-4134) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors