C20ORF195 antibody (70R-3953)

Rabbit polyclonal C20ORF195 antibody raised against the N terminal Of C20Orf195

Synonyms Polyclonal C20ORF195 antibody, Anti-C20ORF195 antibody, Chromosome 20 ORF, Chromosome ORF 20, Chromosome ORF-20 antibody, Chromosome ORF 20 antibody, MGC5356 antibody, Chromosome ORF-20
Specificity C20ORF195 antibody was raised against the N terminal Of C20Orf195
Cross Reactivity Human
Applications WB
Immunogen C20ORF195 antibody was raised using the N terminal Of C20Orf195 corresponding to a region with amino acids RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV
Assay Information C20ORF195 Blocking Peptide, catalog no. 33R-8064, is also available for use as a blocking control in assays to test for specificity of this C20ORF195 antibody


Western Blot analysis using C20ORF195 antibody (70R-3953)

C20ORF195 antibody (70R-3953) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF195 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C20orf195 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C20ORF195 antibody (70R-3953) | C20ORF195 antibody (70R-3953) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors