C20ORF20 antibody (70R-1224)

Rabbit polyclonal C20ORF20 antibody raised against the N terminal Of C20Orf20

Synonyms Polyclonal C20ORF20 antibody, Anti-C20ORF20 antibody, Chromosome ORF 20 antibody, Chromosome 20 ORF, Chromosome ORF 20, Chromosome ORF-20, Chromosome ORF-20 antibody
Specificity C20ORF20 antibody was raised against the N terminal Of C20Orf20
Cross Reactivity Human
Applications WB
Immunogen C20ORF20 antibody was raised using the N terminal Of C20Orf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG
Assay Information C20ORF20 Blocking Peptide, catalog no. 33R-6018, is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody

Images

Western Blot analysis using C20ORF20 antibody (70R-1224)

C20ORF20 antibody (70R-1224) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C20ORF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF20 antibody (70R-1224) | C20ORF20 antibody (70R-1224) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors